General Information

  • ID:  hor005518
  • Uniprot ID:  P83220
  • Protein name:  Probable molt-inhibiting hormone
  • Gene name:  NA
  • Organism:  Jasus lalandii (South African spiny lobster)
  • Family:  arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Jasus (genus), Palinuridae (family), Palinuroidea (superfamily), Achelata (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RFTFDCPGMMGQRYLYEQVEQVCDDCYNLYREEKIAVNCRENCFLNSWFTVCLQATMREHETPRFDIWRSILKA
  • Length:  74(1-74)
  • Propeptide:  RFTFDCPGMMGQRYLYEQVEQVCDDCYNLYREEKIAVNCRENCFLNSWFTVCLQATMREHETPRFDIWRSILKA
  • Signal peptide:  NA
  • Modification:  T74 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops. Has little or no hyperglycemic activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  6-43; 23-39; 26-52
  • Structure ID:  AF-P83220-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P83220-F1.pdbhor005518_AF2.pdbhor005518_ESM.pdb

Physical Information

Mass: 1031557 Formula: C396H597N109O115S9
Absent amino acids: Common amino acids: ERC
pI: 5.04 Basic residues: 10
Polar residues: 22 Hydrophobic residues: 22
Hydrophobicity: -47.3 Boman Index: -17199
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 61.89
Instability Index: 3223.11 Extinction Coefficient cystines: 17335
Absorbance 280nm: 237.47

Literature

  • PubMed ID:  11072117
  • Title:  Characterization and sequence elucidation of a novel peptide with molt-inhibiting activity from the South African spiny lobster, Jasus lalandii.